| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50484348 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_772987 (CHEMBL1837906) |
|---|
| Ki | 27±n/a nM |
|---|
| Citation |  Ganguly, AK; Alluri, SS; Caroccia, D; Biswas, D; Wang, CH; Kang, E; Zhang, Y; McPhail, AT; Carroll, SS; Burlein, C; Munshi, V; Orth, P; Strickland, C Design, synthesis, and X-ray crystallographic analysis of a novel class of HIV-1 protease inhibitors. J Med Chem54:7176-83 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50484348 |
|---|
| n/a |
|---|
| Name | BDBM50484348 |
|---|
| Synonyms: | CHEMBL1835837 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N2O5S |
|---|
| Mol. Mass. | 458.57 |
|---|
| SMILES | C[C@@H]1CN(C[C@@H](O)[C@H](Cc2ccccc2)NC(=O)OCC=C)S(=O)(=O)c2ccccc2C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
