| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
|---|
| Ligand | BDBM50484527 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_791581 (CHEMBL1930718) |
|---|
| Kd | 470±n/a nM |
|---|
| Citation |  Shi, G; Shaw, G; Liang, YH; Subburaman, P; Li, Y; Wu, Y; Yan, H; Ji, X Bisubstrate analogue inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase: New design with improved properties. Bioorg Med Chem20:47-57 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
|---|
| Name: | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
|---|
| Synonyms: | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase | 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase | HPPK | HPPK_ECOLI | JW0138 | PPPK | folK |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18075.55 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | ChEMBL_108237 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
|
|
|
|---|
| BDBM50484527 |
|---|
| n/a |
|---|
| Name | BDBM50484527 |
|---|
| Synonyms: | CHEMBL1928286 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22N10O17P4 |
|---|
| Mol. Mass. | 762.3084 |
|---|
| SMILES | Nc1nc2ncc(COP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OC[C@H]3O[C@H]([C@H](O)[C@@H]3O)n3cnc4c(N)ncnc34)nc2c(=O)[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
