Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50029499
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212346
IC50 8.8±n/a nM
Citation Shuman RTRothenberger RBCampbell CSSmith GFGifford-Moore DSPaschal JWGesellchen PD Structure-activity study of tripeptide thrombin inhibitors using alpha-alkyl amino acids and other conformationally constrained amino acid substitutions. J Med Chem 38:4446-53 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029499
n/a
NameBDBM50029499
Synonyms:CHEMBL141834 | tert-butyloxy carbonyl-D-Phe-thiazolidine-4-carboxylate-Arg-H
TypeSmall organic molecule
Emp. Form.C24H36N6O5S
Mol. Mass.520.645
SMILESCC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)C(=O)N1CSCC1C(=O)N[C@@H](CCCNC(N)=N)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: