| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50491189 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_957350 (CHEMBL2377973) |
|---|
| Kd | 35900±n/a nM |
|---|
| Citation |  Yu, WL; Jones, BD; Kang, M; Hammons, JC; La Clair, JJ; Burkart, MD Spirohexenolide A targets human macrophage migration inhibitory factor (hMIF). J Nat Prod76:817-23 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50491189 |
|---|
| n/a |
|---|
| Name | BDBM50491189 |
|---|
| Synonyms: | CHEMBL2375653 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28O5 |
|---|
| Mol. Mass. | 408.4868 |
|---|
| SMILES | C[C@H]1C[C@@]23OC(=O)\C(C2=O)=C2\OC\C(\C=C2)=C/[C@H](O)C\C=C\C(\C)=C\[C@@]3(C)C=C1C |r,c:15,17,30,t:10,22,25| |
|---|
| Structure | 
|
|---|
Search and Browse
