Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM26390 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_957491 (CHEMBL2378229) |
---|
Ki | 7.9±n/a nM |
---|
Citation | Engelhardt, H; Schultes, S; de Graaf, C; Nijmeijer, S; Vischer, HF; Zuiderveld, OP; Dobler, J; Stachurski, K; Mayer, M; Arnhof, H; Scharn, D; Haaksma, EE; de Esch, IJ; Leurs, R Bispyrimidines as potent histamine H(4) receptor ligands: delineation of structure-activity relationships and detailed H(4) receptor binding mode. J Med Chem56:4264-76 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM26390 |
---|
n/a |
---|
Name | BDBM26390 |
Synonyms: | 4-(4-methylpiperazin-1-yl)-6-phenylpyrimidin-2-amine | 6-aryl-2-aminopyrimidine, 3 |
Type | Small organic molecule |
Emp. Form. | C15H19N5 |
Mol. Mass. | 269.3449 |
SMILES | CN1CCN(CC1)c1cc(nc(N)n1)-c1ccccc1 |
Structure |
|