Reaction Details |
| Report a problem with these data |
Target | Muscarinic receptor M1 |
---|
Ligand | BDBM50407329 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_140162 (CHEMBL745467) |
---|
Ki | 25±n/a nM |
---|
Citation | Kiesewetter, DO; Lee, J; Lang, L; Park, SG; Paik, CH; Eckelman, WC Preparation of 18F-labeled muscarinic agonist with M2 selectivity. J Med Chem38:5-8 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Muscarinic receptor M1 |
---|
Name: | Muscarinic receptor M1 |
Synonyms: | Muscarinic acetylcholine receptor M1 |
Type: | PROTEIN |
Mol. Mass.: | 15022.43 |
Organism: | Bos taurus |
Description: | ChEMBL_140161 |
Residue: | 139 |
Sequence: | ETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRTPRLLQAYS
WKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKG
RERAGKGQKPRGKEQLAKR
|
|
|
BDBM50407329 |
---|
n/a |
---|
Name | BDBM50407329 |
Synonyms: | CHEMBL2112938 |
Type | Small organic molecule |
Emp. Form. | C10H14FN3S2 |
Mol. Mass. | 259.367 |
SMILES | CN1CCC=C(C1)c1nsnc1SCCF |c:4| |
Structure |
|