| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Muscarinic receptor M1 |
|---|
| Ligand | BDBM50407329 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_140162 (CHEMBL745467) |
|---|
| Ki | 25±n/a nM |
|---|
| Citation |  Kiesewetter, DO; Lee, J; Lang, L; Park, SG; Paik, CH; Eckelman, WC Preparation of 18F-labeled muscarinic agonist with M2 selectivity. J Med Chem38:5-8 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Muscarinic receptor M1 |
|---|
| Name: | Muscarinic receptor M1 |
|---|
| Synonyms: | Muscarinic acetylcholine receptor M1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15022.43 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_140161 |
|---|
| Residue: | 139 |
|---|
| Sequence: | ETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRTPRLLQAYS
WKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKG
RERAGKGQKPRGKEQLAKR
|
|
|
|---|
| BDBM50407329 |
|---|
| n/a |
|---|
| Name | BDBM50407329 |
|---|
| Synonyms: | CHEMBL2112938 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H14FN3S2 |
|---|
| Mol. Mass. | 259.367 |
|---|
| SMILES | CN1CCC=C(C1)c1nsnc1SCCF |c:4| |
|---|
| Structure | 
|
|---|
Search and Browse
