Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50008984 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_960777 (CHEMBL2387946) |
---|
IC50 | 3.4±n/a nM |
---|
Citation | Petrov, RR; Lee, YS; Vardanyan, RS; Liu, L; Ma, SW; Davis, P; Lai, J; Porreca, F; Vanderah, TW; Hruby, VJ Effect of anchoring 4-anilidopiperidines to opioid peptides. Bioorg Med Chem Lett23:3434-7 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50008984 |
---|
n/a |
---|
Name | BDBM50008984 |
Synonyms: | 4-(4-Chloro-benzyl)-2-(1-methyl-azepan-4-yl)-2H-phthalazin-1-one | CHEMBL596 | Duragesic-100 | Duragesic-12 | Duragesic-25 | Duragesic-50 | Duragesic-75 | FENTANYL | FENTANYL CITRATE | FENTANYL-HCl | Fentanyl-100 | Fentanyl-12 | Fentanyl-25 | Fentanyl-50 | Fentanyl-75 | Fentora | Innovar | Ionsys | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide(Fentanyl) | N-(1-phenethylpiperidin-4-yl)-N-phenylpropionamide | US20230399418, Compound Fentanyl |
Type | Small organic molecule |
Emp. Form. | C22H28N2O |
Mol. Mass. | 336.4705 |
SMILES | CCC(=O)N(C1CCN(CCc2ccccc2)CC1)c1ccccc1 |
Structure |
|