| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50037123 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157870 (CHEMBL879227) |
|---|
| Ki | 270±n/a nM |
|---|
| Citation |  Thompson, SK; Murthy, KH; Zhao, B; Winborne, E; Green, DW; Fisher, SM; DesJarlais, RL; Tomaszek, TA; Meek, TD; Gleason, JG Rational design, synthesis, and crystallographic analysis of a hydroxyethylene-based HIV-1 protease inhibitor containing a heterocyclic P1'--P2' amide bond isostere. J Med Chem37:3100-7 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50037123 |
|---|
| n/a |
|---|
| Name | BDBM50037123 |
|---|
| Synonyms: | CHEMBL108226 | {(1S,2S,4R)-1-Benzyl-4-[5-(2,2-dimethyl-but-3-enoyl)-1H-imidazol-2-yl]-2-hydroxy-5-phenyl-pentyl}-carbamic acid tert-butyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H41N3O4 |
|---|
| Mol. Mass. | 531.6856 |
|---|
| SMILES | CC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@@H](O)C[C@@H](Cc1ccccc1)c1ncc([nH]1)C(=O)C(C)(C)C=C |
|---|
| Structure | 
|
|---|
Search and Browse
