| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM50037391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_99829 (CHEMBL709859) |
|---|
| Ki | 1±n/a nM |
|---|
| Citation |  Daines, RA; Chambers, PA; Eggleston, DS; Foley, JJ; Griswold, DE; Haltiwanger, RC; Jakas, DR; Kingsbury, WD; Martin, LD; Pendrak, I (E)-3-[[[[6-(2-carboxyethenyl)-5-[[8-(4- methoxyphenyl)octyl]oxy]-2-pyridinyl]-methyl]thio]methyl]benzoic acid and related compounds: high affinity leukotriene B4 receptor antagonists. J Med Chem37:3327-36 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37582.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15722 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
|---|
| BDBM50037391 |
|---|
| n/a |
|---|
| Name | BDBM50037391 |
|---|
| Synonyms: | 5-{2-(2-Carboxy-ethyl)-3-[6-(4-oxo-8-propyl-chroman-7-yloxy)-hexyl]-phenoxy}-pentanoic acid | CHEMBL95453 | Ro-25-3562 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H42O8 |
|---|
| Mol. Mass. | 554.6711 |
|---|
| SMILES | CCCc1c(OCCCCCCc2cccc(OCCCCC(O)=O)c2CCC(O)=O)ccc2C(=O)CCOc12 |
|---|
| Structure | 
|
|---|
Search and Browse
