| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50037811 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157568 (CHEMBL763319) |
|---|
| Ki | 5±n/a nM |
|---|
| Citation |  Podlogar, BL; Farr, RA; Friedrich, D; Tarnus, C; Huber, EW; Cregge, RJ; Schirlin, D Design, synthesis, and conformational analysis of a novel macrocyclic HIV-protease inhibitor. J Med Chem37:3684-92 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50037811 |
|---|
| n/a |
|---|
| Name | BDBM50037811 |
|---|
| Synonyms: | CHEMBL123016 | {(S)-1-[(S)-3-Benzylcarbamoyl-1-(4-benzyloxy-benzyl)-3,3-difluoro-2-oxo-propylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H39F2N3O6 |
|---|
| Mol. Mass. | 671.7296 |
|---|
| SMILES | CC(C)[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@@H](Cc1ccc(OCc2ccccc2)cc1)C(=O)C(F)(F)C(=O)NCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
