Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50037869
Substrate/Competitorn/a
Meas. Tech.ChEMBL_47965
IC50 0.6±n/a nM
Citation Lowe JAHageman DLDrozda SEMcLean SBryce DKCrawford RTZorn SMorrone JBordner J 5-Phenyl-3-ureidobenzazepin-2-ones as cholecystokinin-B receptor antagonists. J Med Chem 37:3789-811 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:CCK-2 receptor | CCK-B receptor | CCK-BR | CCKBR | Cholecystokinin A | Cholecystokinin-2 Receptor | Gastrin/cholecystokinin type B receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48445.79
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-2 receptors in HEK 293 cells.
Residue:447
Sequence:
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037869
n/a
NameBDBM50037869
Synonyms:CHEMBL334100 | N-tert-Butyl-2-{(3R,5R)-3-[3-(3-chloro-phenyl)-ureido]-5-cyclohexyl-8-methyl-2-oxo-2,3,4,5-tetrahydro-benzo[b]azepin-1-yl}-acetamide
TypeSmall organic molecule
Emp. Form.C30H39ClN4O3
Mol. Mass.539.109
SMILESCc1ccc2[C@H](C[C@@H](NC(=O)Nc3cccc(Cl)c3)C(=O)N(CC(=O)NC(C)(C)C)c2c1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: