| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50040133 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_223425 (CHEMBL844035) |
|---|
| IC50 | 83±n/a nM |
|---|
| Citation |  Kawasaki, AM; Knapp, RJ; Kramer, TH; Walton, A; Wire, WS; Hashimoto, S; Yamamura, HI; Porreca, F; Burks, TF; Hruby, VJ Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs. J Med Chem36:750-7 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50040133 |
|---|
| n/a |
|---|
| Name | BDBM50040133 |
|---|
| Synonyms: | CHEMBL444626 | Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Arg-Cys)-lys |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C58H93N21O13S2 |
|---|
| Mol. Mass. | 1356.622 |
|---|
| SMILES | CC[C@H](C)[C@@H]1NC(=O)[C@@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](CSSC[C@@H](NC(=O)[C@@H](CCCNC(N)=N)NC1=O)C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
