| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50040573 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159442 (CHEMBL763238) |
|---|
| IC50 | 20000±n/a nM |
|---|
| Citation |  De Voss, JJ; Sui, Z; DeCamp, DL; Salto, R; Babé, LM; Craik, CS; Ortiz de Montellano, PR Haloperidol-based irreversible inhibitors of the HIV-1 and HIV-2 proteases. J Med Chem37:665-73 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50040573 |
|---|
| n/a |
|---|
| Name | BDBM50040573 |
|---|
| Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-phenyl-but-2-yn-1-one | CHEMBL161488 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20ClNO2 |
|---|
| Mol. Mass. | 353.842 |
|---|
| SMILES | OC1(CCN(CC#CC(=O)c2ccccc2)CC1)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
