Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50041176 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_53004 (CHEMBL664434) |
---|
IC50 | 35±n/a nM |
---|
Citation | Gangjee, A; Devraj, R; McGuire, JJ; Kisliuk, RL; Queener, SF; Barrows, LR Classical and nonclassical furo[2,3-d]pyrimidines as novel antifolates: synthesis and biological activities. J Med Chem37:1169-76 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 23891.29 |
Organism: | Pneumocystis carinii |
Description: | n/a |
Residue: | 206 |
Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
BDBM50041176 |
---|
n/a |
---|
Name | BDBM50041176 |
Synonyms: | 2-{4-[(2,4-Diamino-furo[2,3-d]pyrimidin-5-ylmethyl)-methyl-amino]-benzoylamino}-pentanedioic acid | CHEMBL278515 |
Type | Small organic molecule |
Emp. Form. | C20H22N6O6 |
Mol. Mass. | 442.4253 |
SMILES | CN(Cc1coc2nc(N)nc(N)c12)c1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O |
Structure |
|