Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50043715 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_136094 (CHEMBL745616) |
---|
IC50 | 5500±n/a nM |
---|
Citation | Misicka, A; Lipkowski, AW; Horvath, R; Davis, P; Yamamura, HI; Porreca, F; Hruby, VJ Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors. J Med Chem37:141-5 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50043715 |
---|
n/a |
---|
Name | BDBM50043715 |
Synonyms: | CHEMBL284621 | {(4R,7R,10S,13R)-13-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-10-benzyl-4-[(R)-1-(carbamoylmethyl-carbamoyl)-2-methyl-propylcarbamoyl]-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradec-7-yl}-acetic acid |
Type | Small organic molecule |
Emp. Form. | C39H54N8O10S2 |
Mol. Mass. | 859.024 |
SMILES | CC(C)[C@@H](NC(=O)[C@H]1NC(=O)[C@@H](CC(O)=O)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(C)(C)SSC1(C)C)C(=O)NCC(N)=O |
Structure |
|