| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50043973 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201739 (CHEMBL803935) |
|---|
| IC50 | 11000±n/a nM |
|---|
| Citation |  Reddy, NL; Hu, LY; Cotter, RE; Fischer, JB; Wong, WJ; McBurney, RN; Weber, E; Holmes, DL; Wong, ST; Prasad, R Synthesis and structure-activity studies of N,N'-diarylguanidine derivatives. N-(1-naphthyl)-N'-(3-ethylphenyl)-N'-methylguanidine: a new, selective noncompetitive NMDA receptor antagonist. J Med Chem37:260-7 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50043973 |
|---|
| n/a |
|---|
| Name | BDBM50043973 |
|---|
| Synonyms: | CHEMBL90288 | N-Methyl-N,N'-di-naphthalen-1-yl-N'-phenyl-guanidine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H23N3 |
|---|
| Mol. Mass. | 401.5023 |
|---|
| SMILES | CN(C(=N)N(c1ccccc1)c1cccc2ccccc12)c1cccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
