| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50044427 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_226538 |
|---|
| Ki | 4815.0±n/a nM |
|---|
| Citation |  Linders, JT; Monn, JA; Mattson, MV; George, C; Jacobson, AE; Rice, KC Synthesis and binding properties of MK-801 isothiocyanates; (+)-3-isothiocyanato-5-methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten- 5,10-imine hydrochloride: a new, potent and selective electrophilic affinity ligand for the NMDA receptor-coupled phencyclidine binding site. J Med Chem36:2499-507 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50044427 |
|---|
| n/a |
|---|
| Name | BDBM50044427 |
|---|
| Synonyms: | 1-methyl-16-azatetracyclo[7.6.1.02,7.010,15]hexadeca-2(7),3,5,10,12,14-hexaen-4-yl isothiocyanate | CHEMBL312471 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14N2S |
|---|
| Mol. Mass. | 278.371 |
|---|
| SMILES | C[C@]12N[C@H](Cc3ccc(cc13)N=C=S)c1ccccc21 |
|---|
| Structure | 
|
|---|
Search and Browse
