Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 2
LigandBDBM50034128
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144149
Ki 0.3±n/a nM
Citation Kirby DAKoerber SCCraig AGFeinstein RDDelmas LBrown MRRivier JE Defining structural requirements for neuropeptide Y receptors using truncated and conformationally restricted analogues. J Med Chem 36:385-93 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 2
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | NPY-Y2 receptor | NPY2-R | NPY2R | Neuropeptide Y receptor type 2 | Y2 receptor | neuropeptide Y receptor Y2
Type:Enzyme Catalytic Domain
Mol. Mass.:42734.65
Organism:Homo sapiens (Human)
Description:NPY-Y2 NPY2R HUMAN::P49146
Residue:381
Sequence:
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034128
n/a
NameBDBM50034128
Synonyms:CHEMBL441396 | Neuropeptide Y(NPY) | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: