| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 4 |
|---|
| Ligand | BDBM50436989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1540691 (CHEMBL3744958) |
|---|
| EC50 | 1.5±n/a nM |
|---|
| Citation |  Nirogi, R; Mohammed, AR; Shinde, AK; Bogaraju, N; Gagginapalli, SR; Ravella, SR; Kota, L; Bhyrapuneni, G; Muddana, NR; Benade, V; Palacharla, RC; Jayarajan, P; Subramanian, R; Goyal, VK Synthesis and SAR of Imidazo[1,5-a]pyridine derivatives as 5-HT4 receptor partial agonists for the treatment of cognitive disorders associated with Alzheimer's disease. Eur J Med Chem103:289-301 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 4 |
|---|
| Name: | 5-hydroxytryptamine receptor 4 |
|---|
| Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43767.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13639 |
|---|
| Residue: | 388 |
|---|
| Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
|---|
| BDBM50436989 |
|---|
| n/a |
|---|
| Name | BDBM50436989 |
|---|
| Synonyms: | CHEMBL2402904 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H37N5O3 |
|---|
| Mol. Mass. | 455.593 |
|---|
| SMILES | COC(=O)N1CCC(CN2CCC(CNC(=O)c3cccc4nc([nH]c34)C(C)C)CC2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
