Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50049480 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_72512 (CHEMBL685177) |
---|
Ki | >5000±n/a nM |
---|
Citation | Dean, DC; Nargund, RP; Pong, SS; Chaung, LY; Griffin, P; Melillo, DG; Ellsworth, RL; Van der Ploeg, LH; Patchett, AA; Smith, RG Development of a high specific activity sulfur-35-labeled sulfonamide radioligand that allowed the identification of a new growth hormone secretagogue receptor. J Med Chem39:1767-70 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50049480 |
---|
n/a |
---|
Name | BDBM50049480 |
Synonyms: | 3-Amino-3-methyl-N-{(S)-2-oxo-1-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-2,3,4,5-tetrahydro-1H-benzo[b]azepin-3-yl}-butyramide | CHEMBL300651 | L-692428 |
Type | Small organic molecule |
Emp. Form. | C29H31N7O2 |
Mol. Mass. | 509.6021 |
SMILES | CC(C)(N)CC(=O)N[C@H]1CCc2ccccc2N(Cc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)C1=O |
Structure |
|