Reaction Details |
| Report a problem with these data |
Target | CAAX prenyl protease 2 |
---|
Ligand | BDBM50500104 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1541784 (CHEMBL3742598) |
---|
IC50 | 38000±n/a nM |
---|
Citation | Mohammed, I; Hampton, SE; Ashall, L; Hildebrandt, ER; Kutlik, RA; Manandhar, SP; Floyd, BJ; Smith, HE; Dozier, JK; Distefano, MD; Schmidt, WK; Dore, TM 8-Hydroxyquinoline-based inhibitors of the Rce1 protease disrupt Ras membrane localization in human cells. Bioorg Med Chem24:160-78 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
CAAX prenyl protease 2 |
---|
Name: | CAAX prenyl protease 2 |
Synonyms: | CAAX prenyl protease 2 | FACE-2 | FACE2 | FACE2_HUMAN | Farnesylated proteins-converting enzyme 2 | Prenyl protein specific protease | Prenyl protein-specific endoprotease 2 | RCE1 | RCE1 homolog | RCE1A | RCE1B | hRCE1 |
Type: | PROTEIN |
Mol. Mass.: | 35839.94 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_194935 |
Residue: | 329 |
Sequence: | MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL
PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL
LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR
ACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVF
GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQ
PLTDPKLYGSLPLCVLLERAGDSEAPLCS
|
|
|
BDBM50500104 |
---|
n/a |
---|
Name | BDBM50500104 |
Synonyms: | CHEMBL3739592 |
Type | Small organic molecule |
Emp. Form. | C22H17N3O3 |
Mol. Mass. | 371.3887 |
SMILES | OC(=O)c1ccc(NC(c2ccccn2)c2ccc3cccnc3c2O)cc1 |
Structure |
|