Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50049604 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_55116 (CHEMBL884367) |
---|
IC50 | 7.3±n/a nM |
---|
Citation | Gangjee, A; Zhu, Y; Queener, SF; Francom, P; Broom, AD Nonclassical 2,4-diamino-8-deazafolate analogues as inhibitors of dihydrofolate reductases from rat liver, Pneumocystis carinii, and Toxoplasma gondii. J Med Chem39:1836-45 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50049604 |
---|
n/a |
---|
Name | BDBM50049604 |
Synonyms: | 6-[(Methyl-naphthalen-1-yl-amino)-methyl]-pyrido[3,2-d]pyrimidine-2,4-diamine | CHEMBL54538 |
Type | Small organic molecule |
Emp. Form. | C19H18N6 |
Mol. Mass. | 330.3864 |
SMILES | CN(Cc1ccc2nc(N)nc(N)c2n1)c1cccc2ccccc12 |
Structure |
|