Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18224 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_55116 (CHEMBL884367) |
---|
IC50 | 1.5±n/a nM |
---|
Citation | Gangjee, A; Zhu, Y; Queener, SF; Francom, P; Broom, AD Nonclassical 2,4-diamino-8-deazafolate analogues as inhibitors of dihydrofolate reductases from rat liver, Pneumocystis carinii, and Toxoplasma gondii. J Med Chem39:1836-45 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM18224 |
---|
n/a |
---|
Name | BDBM18224 |
Synonyms: | 6-[(2,5-dimethoxyphenyl)methyl]-5-methylpyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL7492 | PTX | Piritrexim | [2-amino-6-(2,5-dimethoxybenzyl)-5-methyl-pyrido[2,3-d]pyrimidin-4-yl]amine;2-hydroxyethanesulfonic acid |
Type | Small organic molecule |
Emp. Form. | C17H19N5O2 |
Mol. Mass. | 325.3651 |
SMILES | COc1ccc(OC)c(Cc2cnc3nc(N)nc(N)c3c2C)c1 |
Structure |
|