| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50500176 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1543994 (CHEMBL3750239) |
|---|
| Ki | <1.000000±n/a nM |
|---|
| Citation |  Burger, MT; Nishiguchi, G; Han, W; Lan, J; Simmons, R; Atallah, G; Ding, Y; Tamez, V; Zhang, Y; Mathur, M; Muller, K; Bellamacina, C; Lindvall, MK; Zang, R; Huh, K; Feucht, P; Zavorotinskaya, T; Dai, Y; Basham, S; Chan, J; Ginn, E; Aycinena, A; Holash, J; Castillo, J; Langowski, JL; Wang, Y; Chen, MY; Lambert, A; Fritsch, C; Kauffmann, A; Pfister, E; Vanasse, KG; Garcia, PD Identification of N-(4-((1R,3S,5S)-3-Amino-5-methylcyclohexyl)pyridin-3-yl)-6-(2,6-difluorophenyl)-5-fluoropicolinamide (PIM447), a Potent and Selective Proviral Insertion Site of Moloney Murine Leukemia (PIM) 1, 2, and 3 Kinase Inhibitor in Clinical Trials for Hematological Malignancies. J Med Chem58:8373-86 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50500176 |
|---|
| n/a |
|---|
| Name | BDBM50500176 |
|---|
| Synonyms: | CHEMBL3676290 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20F2N4OS |
|---|
| Mol. Mass. | 414.472 |
|---|
| SMILES | N[C@H]1CCC[C@H](C1)c1ccncc1NC(=O)c1csc(n1)-c1c(F)cccc1F |
|---|
| Structure | 
|
|---|
Search and Browse
