Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50050430 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_196952 (CHEMBL801325) |
---|
IC50 | 700±n/a nM |
---|
Citation | Flavin, MT; Rizzo, JD; Khilevich, A; Kucherenko, A; Sheinkman, AK; Vilaychack, V; Lin, L; Chen, W; Greenwood, EM; Pengsuparp, T; Pezzuto, JM; Hughes, SH; Flavin, TM; Cibulski, M; Boulanger, WA; Shone, RL; Xu, ZQ Synthesis, chromatographic resolution, and anti-human immunodeficiency virus activity of (+/-)-calanolide A and its enantiomers. J Med Chem39:1303-13 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50050430 |
---|
n/a |
---|
Name | BDBM50050430 |
Synonyms: | (10S,12S)-12-Hydroxy-6,6,10,11-tetramethyl-4-propyl-11,12-dihydro-6H,10H-dipyrano[2,3-f;2',3'-h]chromen-2-one | CHEMBL282382 |
Type | Small organic molecule |
Emp. Form. | C22H26O5 |
Mol. Mass. | 370.4388 |
SMILES | CCCc1cc(=O)oc2c3[C@@H](O)C(C)[C@H](C)Oc3c3C=CC(C)(C)Oc3c12 |c:20| |
Structure |
|