| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM50053240 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_99482 (CHEMBL704370) |
|---|
| IC50 | >300±n/a nM |
|---|
| Citation |  Chan, WK; Huang, FC; Morrissette, MM; Warus, JD; Moriarty, KJ; Galemmo, RA; Dankulich, WD; Poli, G; Sutherland, CA Structure-activity relationships study of two series of leukotriene B4 antagonists: novel indolyl and naphthyl compounds substituted with a 2-[methyl(2-phenethyl)amino]-2-oxoethyl side chain. J Med Chem39:3756-68 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37582.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15722 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
|---|
| BDBM50053240 |
|---|
| n/a |
|---|
| Name | BDBM50053240 |
|---|
| Synonyms: | (E)-3-{5-Benzyloxy-1-[(methyl-phenethyl-carbamoyl)-methyl]-1H-indol-3-yl}-acrylic acid ethyl ester | CHEMBL332422 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H32N2O4 |
|---|
| Mol. Mass. | 496.5968 |
|---|
| SMILES | CCOC(=O)\C=C\c1cn(CC(=O)N(C)CCc2ccccc2)c2ccc(OCc3ccccc3)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
