Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50054440 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145294 (CHEMBL752188) |
---|
Ki | 280±n/a nM |
---|
Citation | Chang, AC; Cowan, A; Takemori, AE; Portoghese, PS Aspartic acid conjugates of 2-(3,4-dichlorophenyl)-N-methyl-N-[(1S)-1(3-aminophenyl)-2-(1-pyrrolidi nyl) ethyl]acetamide: kappa opioid receptor agonists with limited access to the central nervous system. J Med Chem39:4478-82 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50054440 |
---|
n/a |
---|
Name | BDBM50054440 |
Synonyms: | (R)-3-Amino-N-[3-((S)-1-{[2-(3,4-dichloro-phenyl)-acetyl]-methyl-amino}-2-pyrrolidin-1-yl-ethyl)-phenyl]-succinamic acid | CHEMBL344885 |
Type | Small organic molecule |
Emp. Form. | C25H30Cl2N4O4 |
Mol. Mass. | 521.436 |
SMILES | CN([C@H](CN1CCCC1)c1cccc(NC(=O)[C@H](N)CC(O)=O)c1)C(=O)Cc1ccc(Cl)c(Cl)c1 |
Structure |
|