Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50503849 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1812368 (CHEMBL4311828) |
---|
IC50 | 139±n/a nM |
---|
Citation | Pehere, AD; Nguyen, S; Garlick, SK; Wilson, DW; Hudson, I; Sykes, MJ; Morton, JD; Abell, AD Tripeptide analogues of MG132 as protease inhibitors. Bioorg Med Chem27:436-441 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50503849 |
---|
n/a |
---|
Name | BDBM50503849 |
Synonyms: | CHEMBL4590466 |
Type | Small organic molecule |
Emp. Form. | C29H39N3O5 |
Mol. Mass. | 509.6371 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1)C=O |r| |
Structure |
|