| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50057318 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52850 (CHEMBL664374) |
|---|
| IC50 | 929000.0±n/a nM |
|---|
| Citation |  Gangjee, A; Mavandadi, F; Queener, SF Effect of N9-methylation and bridge atom variation on the activity of 5-substituted 2,4-diaminopyrrolo[2,3-d]pyrimidines against dihydrofolate reductases from Pneumocystis carinii and Toxoplasma gondii. J Med Chem40:1173-7 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50057318 |
|---|
| n/a |
|---|
| Name | BDBM50057318 |
|---|
| Synonyms: | 5-(Naphthalen-2-ylsulfanylmethyl)-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine | CHEMBL275893 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15N5S |
|---|
| Mol. Mass. | 321.4 |
|---|
| SMILES | Nc1nc(N)c2c(CSc3ccc4ccccc4c3)c[nH]c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
