Reaction Details |
| Report a problem with these data |
Target | Type 1 fimbrin D-mannose specific adhesin |
---|
Ligand | BDBM50507943 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1831845 (CHEMBL4331853) |
---|
IC50 | 280±n/a nM |
---|
Citation | Maddirala, AR; Klein, R; Pinkner, JS; Kalas, V; Hultgren, SJ; Janetka, JW Biphenyl Gal and GalNAc FmlH Lectin Antagonists of Uropathogenic E. coli (UPEC): Optimization through Iterative Rational Drug Design. J Med Chem62:467-479 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Type 1 fimbrin D-mannose specific adhesin |
---|
Name: | Type 1 fimbrin D-mannose specific adhesin |
Synonyms: | Adhesin protein fimH | FIMH_ECOLI | fimH |
Type: | PROTEIN |
Mol. Mass.: | 31474.61 |
Organism: | Escherichia coli (strain K12) |
Description: | ChEMBL_1298296 |
Residue: | 300 |
Sequence: | MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRT
DKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
GCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQ
GVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
|
|
|
BDBM50507943 |
---|
n/a |
---|
Name | BDBM50507943 |
Synonyms: | CHEMBL4546828 |
Type | Small organic molecule |
Emp. Form. | C19H19NO10 |
Mol. Mass. | 421.3549 |
SMILES | OC[C@H]1O[C@@H](Oc2ccccc2-c2cc(cc(c2)[N+]([O-])=O)C(O)=O)[C@H](O)[C@@H](O)[C@H]1O |r| |
Structure |
|