Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMast cell carboxypeptidase A
LigandBDBM50058391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45632
Ki 17000±n/a nM
Citation Veale CABernstein PRBohnert CMBrown FJBryant CDamewood JREarley RFeeney SWEdwards PDGomes BHulsizer JMKosmider BJKrell RDMoore GSalcedo TWShaw ASilberstein DSSteelman GBStein MStrimpler AThomas RMVacek EPWilliams JCWolanin DJWoolson S Orally active trifluoromethyl ketone inhibitors of human leukocyte elastase. J Med Chem 40:3173-81 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mast cell carboxypeptidase A
Name:Mast cell carboxypeptidase A
Synonyms:Carboxypeptidase A3 | MC-CPA
Type:PROTEIN
Mol. Mass.:48684.88
Organism:Homo sapiens (Human)
Description:ChEMBL_45634
Residue:417
Sequence:
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058391
n/a
NameBDBM50058391
Synonyms:(S)-1-[(S)-2-(4-Methoxy-benzoylamino)-3-methyl-butyryl]-pyrrolidine-2-carboxylic acid ((S)-3,3,3-trifluoro-1-isopropyl-2-oxo-propyl)-amide | CHEMBL55210
TypeSmall organic molecule
Emp. Form.C24H32F3N3O5
Mol. Mass.499.5232
SMILESCOc1ccc(cc1)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: