| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stimulator of interferon genes protein |
|---|
| Ligand | BDBM50509406 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1838268 (CHEMBL4338401) |
|---|
| EC50 | 170±n/a nM |
|---|
| Citation |  Novotná, B; Vaneková, L; Zav?el, M; Bud??ínský, M; Dejmek, M; Smola, M; Gutten, O; Tehrani, ZA; Pimková Polidarová, M; Brázdová, A; Liboska, R; ?t?pánek, I; Vav?ina, Z; Jandu?ík, T; Nencka, R; Rulí?ek, L; Bou?a, E; Brynda, J; Páv, O; Birku?, G Enzymatic Preparation of 2'-5',3'-5'-Cyclic Dinucleotides, Their Binding Properties to Stimulator of Interferon Genes Adaptor Protein, and Structure/Activity Correlations. J Med Chem62:10676-10690 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Stimulator of interferon genes protein |
|---|
| Name: | Stimulator of interferon genes protein |
|---|
| Synonyms: | ERIS | Endoplasmic reticulum interferon stimulator | MITA | Mediator of IRF3 activation | STING | STING1 | STING_HUMAN | Synonyms=ERIS | TMEM173 | Transmembrane protein 173 | hMITA | hSTING |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 42195.64 |
|---|
| Organism: | Human |
|---|
| Description: | Q86WV6 |
|---|
| Residue: | 379 |
|---|
| Sequence: | MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
|
|
|
|---|
| BDBM50509406 |
|---|
| n/a |
|---|
| Name | BDBM50509406 |
|---|
| Synonyms: | CHEMBL4435159 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N10O13P2 |
|---|
| Mol. Mass. | 674.4113 |
|---|
| SMILES | Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2COP(O)(=O)O[C@@H]3[C@H](O)[C@@H](COP(O)(=O)O[C@@H]1[C@@H]2O)O[C@H]3n1cnc2c(N)ncnc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
