Reaction Details |
| Report a problem with these data |
Target | Stimulator of interferon genes protein |
---|
Ligand | BDBM50506263 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1838264 (CHEMBL4338397) |
---|
EC50 | 20±n/a nM |
---|
Citation | Novotná, B; Vaneková, L; Zav?el, M; Bud??ínský, M; Dejmek, M; Smola, M; Gutten, O; Tehrani, ZA; Pimková Polidarová, M; Brázdová, A; Liboska, R; ?t?pánek, I; Vav?ina, Z; Jandu?ík, T; Nencka, R; Rulí?ek, L; Bou?a, E; Brynda, J; Páv, O; Birku?, G Enzymatic Preparation of 2'-5',3'-5'-Cyclic Dinucleotides, Their Binding Properties to Stimulator of Interferon Genes Adaptor Protein, and Structure/Activity Correlations. J Med Chem62:10676-10690 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Stimulator of interferon genes protein |
---|
Name: | Stimulator of interferon genes protein |
Synonyms: | ERIS | Endoplasmic reticulum interferon stimulator | MITA | Mediator of IRF3 activation | STING | STING1 | STING_HUMAN | Synonyms=ERIS | TMEM173 | Transmembrane protein 173 | hMITA | hSTING |
Type: | Protein |
Mol. Mass.: | 42195.64 |
Organism: | Human |
Description: | Q86WV6 |
Residue: | 379 |
Sequence: | MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
|
|
|
BDBM50506263 |
---|
n/a |
---|
Name | BDBM50506263 |
Synonyms: | CHEMBL4465054 | US11401295, Compound 2',3'-cGAMP |
Type | Small organic molecule |
Emp. Form. | C20H24N10O13P2 |
Mol. Mass. | 674.4113 |
SMILES | [H][C@]12COP(O)(=O)O[C@@]3([H])[C@@H](O)[C@@H](O[C@]3([H])COP(O)(=O)O[C@@]([H])([C@@H](O1)n1cnc3c1nc(N)[nH]c3=O)[C@@H]2O)n1cnc2c(N)ncnc12 |r| |
Structure |
|