| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase 16 |
|---|
| Ligand | BDBM50511383 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1844763 (CHEMBL4345190) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Wells, C; Couņago, RM; Limas, JC; Almeida, TL; Cook, JG; Drewry, DH; Elkins, JM; Gileadi, O; Kapadia, NR; Lorente-Macias, A; Pickett, JE; Riemen, A; Ruela-de-Sousa, RR; Willson, TM; Zhang, C; Zuercher, WJ; Zutshi, R; Axtman, AD SGC-AAK1-1: A Chemical Probe Targeting AAK1 and BMP2K. ACS Med Chem Lett11:340-345 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase 16 |
|---|
| Name: | Serine/threonine-protein kinase 16 |
|---|
| Synonyms: | MPSK1 | PKL12 | STK16 | STK16_HUMAN | Serine/threonine-protein kinase 16 | TSF1 | Tyrosine-protein kinase STK16 (STK16) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 34659.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 305 |
|---|
| Sequence: | MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDRE
EAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFL
TEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGS
RQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQ
HTTQI
|
|
|
|---|
| BDBM50511383 |
|---|
| n/a |
|---|
| Name | BDBM50511383 |
|---|
| Synonyms: | CHEMBL4531680 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N5O3S |
|---|
| Mol. Mass. | 413.493 |
|---|
| SMILES | CCN(C)S(=O)(=O)Nc1cccc(c1)-c1ccc2c(NC(=O)C3CC3)n[nH]c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
