| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM314833 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1849815 (CHEMBL4350356) |
|---|
| IC50 | 765±n/a nM |
|---|
| Citation |  Koppitz, M; Bräuer, N; Ter Laak, A; Irlbacher, H; Rotgeri, A; Coelho, AM; Walter, D; Steinmeyer, A; Zollner, TM; Peters, M; Nagel, J Discovery and optimization of pyridyl-cycloalkyl-carboxylic acids as inhibitors of microsomal prostaglandin E synthase-1 for the treatment of endometriosis. Bioorg Med Chem Lett29:2700-2705 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | 5.3.99.3 | Microsomal prostaglandin E synthase 1 | PTGES_MOUSE | Pges | Prostaglandin E synthase | Ptges | mPGES-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17293.88 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_104562 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY
RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG
KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
|
|
|
|---|
| BDBM314833 |
|---|
| n/a |
|---|
| Name | BDBM314833 |
|---|
| Synonyms: | (−) (R) 3-[3-({[4-(5-Chloropyridin-3-yl)phenyl](cyclopentyl)acetyl}amino)-2-methylphenyl]propanoic acid | US10172814, Example 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H29ClN2O3 |
|---|
| Mol. Mass. | 476.994 |
|---|
| SMILES | Cc1c(CCC(O)=O)cccc1NC(=O)[C@H](C1CCCC1)c1ccc(cc1)-c1cncc(Cl)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
