Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM26140 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_34119 (CHEMBL649747) |
---|
IC50 | 14000±n/a nM |
---|
Citation | Weston, GS; Blázquez, J; Baquero, F; Shoichet, BK Structure-based enhancement of boronic acid-based inhibitors of AmpC beta-lactamase. J Med Chem41:4577-86 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM26140 |
---|
n/a |
---|
Name | BDBM26140 |
Synonyms: | 1-benzofuran-2-ylboranediol | 1-benzofuran-2-ylboronic acid, 19 | CHEMBL143399 | Phenylboronic acid, 21 |
Type | Small organic molecule |
Emp. Form. | C8H7BO3 |
Mol. Mass. | 161.95 |
SMILES | OB(O)c1cc2ccccc2o1 |
Structure |
|