| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukocyte elastase |
|---|
| Ligand | BDBM50068298 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_96630 |
|---|
| IC50 | 2660±n/a nM |
|---|
| Citation |  Combrink KD; Gülgeze HB; Meanwell NA; Pearce BC; Zulan P; Bisacchi GS; Roberts DG; Stanley P; Seiler SM 1,2-Benzisothiazol-3-one 1,1-dioxide inhibitors of human mast cell tryptase. J Med Chem 41:4854-60 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukocyte elastase |
|---|
| Name: | Leukocyte elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50068298 |
|---|
| n/a |
|---|
| Name | BDBM50068298 |
|---|
| Synonyms: | 4-Benzyloxycarbonylamino-benzoic acid 1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl ester | CHEMBL144342 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18N2O7S |
|---|
| Mol. Mass. | 466.463 |
|---|
| SMILES | O=C(Nc1ccc(cc1)C(=O)OCN1C(=O)c2ccccc2S1(=O)=O)OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
