Reaction Details |
| Report a problem with these data |
Target | Chymase |
---|
Ligand | BDBM50068892 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_49442 |
---|
Ki | 7.1±n/a nM |
---|
Citation | Eda, M; Ashimori, A; Akahoshi, F; Yoshimura, T; Inoue, Y; Fukaya, C; Nakajima, M; Fukuyama, H; Imada, T; Takai, S; Shiota, N; Miyazaki, M; Nakamura, N Peptidyl human heart chymase inhibitors. 1. Synthesis and inhibitory activity of difluoromethylene ketone derivatives bearing P' binding subsites. Bioorg Med Chem Lett8:913-8 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymase |
---|
Name: | Chymase |
Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
Type: | Enzyme |
Mol. Mass.: | 27340.12 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 247 |
Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
BDBM50068892 |
---|
n/a |
---|
Name | BDBM50068892 |
Synonyms: | 3-(4-{[(S)-1-((S)-2-Acetylamino-3-methyl-butyryl)-pyrrolidine-2-carbonyl]-amino}-2,2-difluoro-3-oxo-5-phenyl-pentanoylamino)-benzoic acid | CHEMBL170838 |
Type | Small organic molecule |
Emp. Form. | C30H34F2N4O7 |
Mol. Mass. | 600.6104 |
SMILES | CC(C)[C@H](NC(C)=O)C(=O)N1CCC[C@H]1C(=O)NC(Cc1ccccc1)C(=O)C(F)(F)C(=O)Nc1cccc(c1)C(O)=O |
Structure |
|