| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50068894 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_49618 |
|---|
| Ki | 364±n/a nM |
|---|
| Citation |  Eda, M; Ashimori, A; Akahoshi, F; Yoshimura, T; Inoue, Y; Fukaya, C; Nakajima, M; Fukuyama, H; Imada, T; Takai, S; Shiota, N; Miyazaki, M; Nakamura, N Peptidyl human heart chymase inhibitors. 1. Synthesis and inhibitory activity of difluoromethylene ketone derivatives bearing P' binding subsites. Bioorg Med Chem Lett8:913-8 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50068894 |
|---|
| n/a |
|---|
| Name | BDBM50068894 |
|---|
| Synonyms: | 3-(4-{[(S)-1-((S)-2-tert-Butoxycarbonylamino-3-methyl-butyryl)-pyrrolidine-2-carbonyl]-amino}-2,2-difluoro-3-oxo-5-phenyl-pentanoylamino)-benzoic acid | 3-(4-{[1-(2-tert-Butoxycarbonylamino-3-methyl-butyryl)-pyrrolidine-2-carbonyl]-amino}-2,2-difluoro-3-oxo-5-phenyl-pentanoylamino)-benzoic acid | CHEMBL287318 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H40F2N4O8 |
|---|
| Mol. Mass. | 658.6895 |
|---|
| SMILES | CC(C)[C@H](NC(=O)OC(C)(C)C)C(=O)N1CCC[C@H]1C(=O)NC(Cc1ccccc1)C(=O)C(F)(F)C(=O)Nc1cccc(c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
