| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lactoylglutathione lyase |
|---|
| Ligand | BDBM50069026 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_71304 (CHEMBL686107) |
|---|
| IC50 | 140500±n/a nM |
|---|
| Citation |  Ly, HD; Clugston, SL; Sampson, PB; Honek, JF Syntheses and kinetic evaluation of hydroxamate-based peptide inhibitors of glyoxalase I. Bioorg Med Chem Lett8:705-10 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lactoylglutathione lyase |
|---|
| Name: | Lactoylglutathione lyase |
|---|
| Synonyms: | Aldoketomutase | GLO1 | Glx I | Glyoxalase 1 (GLO1) | Glyoxalase I | Ketone-aldehyde mutase | LGUL_HUMAN | Methylglyoxalase | S-D-lactoylglutathione methylglyoxal lyase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 20772.95 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q04760 |
|---|
| Residue: | 184 |
|---|
| Sequence: | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
|
|
|
|---|
| BDBM50069026 |
|---|
| n/a |
|---|
| Name | BDBM50069026 |
|---|
| Synonyms: | 2-Amino-4-[1-(ethoxycarbonylmethyl-carbamoyl)-3-(hydroxy-methyl-carbamoyl)-propylcarbamoyl]-butyric acid anion | CHEMBL164262 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H26N4O8 |
|---|
| Mol. Mass. | 390.3889 |
|---|
| SMILES | CCOC(=O)CNC(=O)C(CCC(=O)N(C)O)NC(=O)CCC([NH3+])C([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
