| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nonstructural protein 3 |
|---|
| Ligand | BDBM15236 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1855317 (CHEMBL4356046) |
|---|
| Ki | 800±n/a nM |
|---|
| Citation |  Bernatchez, JA; Tran, LT; Li, J; Luan, Y; Siqueira-Neto, JL; Li, R Drugs for the Treatment of Zika Virus Infection. J Med Chem63:470-489 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nonstructural protein 3 |
|---|
| Name: | Nonstructural protein 3 |
|---|
| Synonyms: | Genome polyprotein | NS3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 7653.58 |
|---|
| Organism: | Zika virus |
|---|
| Description: | ChEMBL_119671 |
|---|
| Residue: | 66 |
|---|
| Sequence: | AETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMK
RGDLPV
|
|
|
|---|
| BDBM15236 |
|---|
| n/a |
|---|
| Name | BDBM15236 |
|---|
| Synonyms: | 3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-chromen-4-one | 3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)chromen-4-one | CHEMBL164 | Cannabiscetin | Myricetin | Myricetin (20) | Myricetin (Myr) | cid_5281672 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O8 |
|---|
| Mol. Mass. | 318.2351 |
|---|
| SMILES | Oc1cc(O)c2c(c1)oc(-c1cc(O)c(O)c(O)c1)c(O)c2=O |
|---|
| Structure | 
|
|---|
Search and Browse
