Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50514056 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1855547 (CHEMBL4356276) |
---|
Ki | 2500±n/a nM |
---|
Citation | Scheiner, M; Dolles, D; Gunesch, S; Hoffmann, M; Nabissi, M; Marinelli, O; Naldi, M; Bartolini, M; Petralla, S; Poeta, E; Monti, B; Falkeis, C; Vieth, M; Hübner, H; Gmeiner, P; Maitra, R; Maurice, T; Decker, M Dual-Acting Cholinesterase-Human Cannabinoid Receptor 2 Ligands Show Pronounced Neuroprotection in Vitro and Overadditive and Disease-Modifying Neuroprotective Effects in Vivo. J Med Chem62:9078-9102 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50514056 |
---|
n/a |
---|
Name | BDBM50514056 |
Synonyms: | CHEMBL4588547 |
Type | Small organic molecule |
Emp. Form. | C37H43N5O2 |
Mol. Mass. | 589.7696 |
SMILES | CCOc1ccc(Cc2nc3cc(ccc3n2CCC(C)C)C(=O)NCCNc2c3CCCCc3nc3ccccc23)cc1 |
Structure |
|