| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
|---|
| Ligand | BDBM50514450 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1856735 (CHEMBL4357464) |
|---|
| IC50 | 250±n/a nM |
|---|
| Citation |  Li, J; Ge, Y; Huang, JX; Strømgaard, K; Zhang, X; Xiong, XF Heterotrimeric G Proteins as Therapeutic Targets in Drug Discovery. J Med Chem63:5013-5030 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
|---|
| Name: | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
|---|
| Synonyms: | G gamma-I | GBG2_HUMAN | GNG2 | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 7851.57 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_117032 |
|---|
| Residue: | 71 |
|---|
| Sequence: | MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
|
|
|
|---|
| BDBM50514450 |
|---|
| n/a |
|---|
| Name | BDBM50514450 |
|---|
| Synonyms: | CHEMBL4443974 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H16Cl6O7 |
|---|
| Mol. Mass. | 641.108 |
|---|
| SMILES | OC(=O)C1CC23C(Cl)C(Cl)=C(Cl)C(Cl)C2(CC1c1c2ccc(O)c(O)c2oc2c(O)c(=O)ccc12)C3(Cl)Cl |t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
