| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 4 |
|---|
| Ligand | BDBM50236140 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1860794 (CHEMBL4361650) |
|---|
| Ki | 1357±n/a nM |
|---|
| Citation |  Berrino, E; Milazzo, L; Micheli, L; Vullo, D; Angeli, A; Bozdag, M; Nocentini, A; Menicatti, M; Bartolucci, G; di Cesare Mannelli, L; Ghelardini, C; Supuran, CT; Carta, F Synthesis and Evaluation of Carbonic Anhydrase Inhibitors with Carbon Monoxide Releasing Properties for the Management of Rheumatoid Arthritis. J Med Chem62:7233-7249 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 4 |
|---|
| Name: | Carbonic anhydrase 4 |
|---|
| Synonyms: | CA-IV | CA4 | CAH4_HUMAN | Carbonate dehydratase IV | Carbonic anhydrase | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 35037.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P22748 |
|---|
| Residue: | 312 |
|---|
| Sequence: | MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
|
|
|
|---|
| BDBM50236140 |
|---|
| n/a |
|---|
| Name | BDBM50236140 |
|---|
| Synonyms: | 4-ethynyl benzene sulfonamide | 4-ethynylbenzenesulfonamide | CHEMBL272881 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H7NO2S |
|---|
| Mol. Mass. | 181.212 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)C#C |
|---|
| Structure | 
|
|---|
Search and Browse
