| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM50517609 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1869381 (CHEMBL4370447) |
|---|
| IC50 | 6.0±n/a nM |
|---|
| Citation |  Xin, BT; Huber, EM; de Bruin, G; Heinemeyer, W; Maurits, E; Espinal, C; Du, Y; Janssens, M; Weyburne, ES; Kisselev, AF; Florea, BI; Driessen, C; van der Marel, GA; Groll, M; Overkleeft, HS Structure-Based Design of Inhibitors Selective for Human Proteasome ?2c or ?2i Subunits. J Med Chem62:1626-1642 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM50517609 |
|---|
| n/a |
|---|
| Name | BDBM50517609 |
|---|
| Synonyms: | CHEMBL4440581 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H41N7O6S |
|---|
| Mol. Mass. | 627.755 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)N=[N+]=[N-])C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(CN)cc1)\C=C\S(C)(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
