| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50073258 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157700 |
|---|
| Ki | 6.6±n/a nM |
|---|
| Citation |  Randad, RS; Lubkowska, L; Eissenstat, MA; Gulnik, SV; Yu, B; Bhat, TN; Clanton, DJ; House, T; Stinson, SF; Erickson, JW Unsymmetric nonpeptidic HIV protease inhibitors containing anthranilamide as a P2' ligand. Bioorg Med Chem Lett8:3537-42 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50073258 |
|---|
| n/a |
|---|
| Name | BDBM50073258 |
|---|
| Synonyms: | CHEMBL118221 | {2-[(1S,2R,3S,4S)-4-(4-Amino-benzoylamino)-1-benzyl-2,3-dihydroxy-5-phenyl-pentylcarbamoyl]-phenyl}-carbamic acid pyridin-2-ylmethyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H39N5O6 |
|---|
| Mol. Mass. | 673.7569 |
|---|
| SMILES | Nc1ccc(cc1)C(=O)N[C@@H](Cc1ccccc1)[C@H](O)[C@H](O)[C@H](Cc1ccccc1)NC(=O)c1ccccc1NC(=O)OCc1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
