| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM1682 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157702 |
|---|
| Ki | 6±n/a nM |
|---|
| Citation |  Han, W; Pelletier, JC; Hodge, CN Tricyclic ureas: a new class of HIV-1 protease inhibitors. Bioorg Med Chem Lett8:3615-20 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM1682 |
|---|
| n/a |
|---|
| Name | BDBM1682 |
|---|
| Synonyms: | (4R,5S,6R,7R)-1,3,4,7-tetrabenzyl-5,6-dihydroxy-1,3-diazepan-2-one | (4R,5S,6R,7R)-Hexahydro-5,6-dihydroxy-1,3,4,7-tetrakis(phenylmethyl)-2H-1,3-diazapin-2-one | CHEMBL120610 | Cyclic Urea diastereomer 24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H34N2O3 |
|---|
| Mol. Mass. | 506.6347 |
|---|
| SMILES | O[C@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccccc2)C(=O)N(Cc2ccccc2)[C@@H]1Cc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
