Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50073341 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157537 |
---|
Ki | 76±n/a nM |
---|
Citation | Baker, CT; Salituro, FG; Court, JJ; Deininger, DD; Kim, EE; Li, B; Novak, PM; Rao, BG; Pazhanisamy, S; Schairer, WC; Tung, RD Design, synthesis, and conformational analysis of a novel series of HIV protease inhibitors. Bioorg Med Chem Lett8:3631-6 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50073341 |
---|
n/a |
---|
Name | BDBM50073341 |
Synonyms: | 1N-[3-cyclopentylmethyl(4-methoxyphenyl)sulfonamido-2-hydroxy-(2S)-propyl]-1N-phenethyl-2-(3-aminosulfonamidocyclohexyl)acetamide | CHEMBL332849 |
Type | Small organic molecule |
Emp. Form. | C32H48N4O7S2 |
Mol. Mass. | 664.876 |
SMILES | COc1ccc(cc1)S(=O)(=O)N(C[C@@H](O)CN(CCc1ccccc1)C(=O)CC1CCCC(C1)NS(N)(=O)=O)CC1CCCC1 |
Structure |
|