| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50073365 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157537 |
|---|
| Ki | 7±n/a nM |
|---|
| Citation |  Baker, CT; Salituro, FG; Court, JJ; Deininger, DD; Kim, EE; Li, B; Novak, PM; Rao, BG; Pazhanisamy, S; Schairer, WC; Tung, RD Design, synthesis, and conformational analysis of a novel series of HIV protease inhibitors. Bioorg Med Chem Lett8:3631-6 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50073365 |
|---|
| n/a |
|---|
| Name | BDBM50073365 |
|---|
| Synonyms: | (S)-2-(3-{(R)-3-[Cyclopentylmethyl-(4-methoxy-phenylsulfonyl)-amino]-2-hydroxy-propyl}-3-phenethyl-ureido)-3-methyl-butyric acid benzyl ester | CHEMBL124003 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H49N3O7S |
|---|
| Mol. Mass. | 679.866 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(C[C@@H](O)CN(CCc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)OCc1ccccc1)CC1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
