| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene C4 synthase |
|---|
| Ligand | BDBM50519578 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1876789 (CHEMBL4378183) |
|---|
| IC50 | 12±n/a nM |
|---|
| Citation |  Munck Af Rosenschöld, M; Johannesson, P; Nikitidis, A; Tyrchan, C; Chang, HF; Rönn, R; Chapman, D; Ullah, V; Nikitidis, G; Glader, P; Käck, H; Bonn, B; Wågberg, F; Björkstrand, E; Andersson, U; Swedin, L; Rohman, M; Andreasson, T; Bergström, EL; Jiang, F; Zhou, XH; Lundqvist, AJ; Malmberg, A; Ek, M; Gordon, E; Pettersen, A; Ripa, L; Davis, AM Discovery of the Oral Leukotriene C4 Synthase Inhibitor (1 J Med Chem62:7769-7787 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene C4 synthase |
|---|
| Name: | Leukotriene C4 synthase |
|---|
| Synonyms: | LTC4 synthase | LTC4S | LTC4S_HUMAN | Leukotriene-C(4) synthase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16575.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_961179 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
|
|
|
|---|
| BDBM50519578 |
|---|
| n/a |
|---|
| Name | BDBM50519578 |
|---|
| Synonyms: | CHEMBL4445815 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H16F6N2O4 |
|---|
| Mol. Mass. | 462.3425 |
|---|
| SMILES | COc1cc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC(F)(F)F)c1cccc(c1)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
